PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G2813
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 289aa    MW: 32777.3 Da    PI: 7.3447
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G2813genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.61.6e-191158148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lvd+++++G   Wk++++  g++R++k+c++rw +yl
      Gh_A11G2813 11 KGPWTPEEDRILVDYIQKHGHSKWKSVPALAGLNRCGKSCRLRWTNYL 58
                     79********************************************97 PP

2Myb_DNA-binding52.98.4e-1764107146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++ eE++l++d+++++G++ W++Iar+++ gRt++++k+ w++
      Gh_A11G2813  64 RGNFSSEEEQLIIDLHALMGNK-WSAIARHLP-GRTDNEVKNLWNS 107
                      89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.486662IPR017930Myb domain
SuperFamilySSF466896.12E-328105IPR009057Homeodomain-like
SMARTSM007179.9E-161060IPR001005SANT/Myb domain
PfamPF002491.4E-171158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-251265IPR009057Homeodomain-like
CDDcd001672.43E-121358No hitNo description
SMARTSM007171.3E-1463111IPR001005SANT/Myb domain
PROSITE profilePS5129420.88163113IPR017930Myb domain
PfamPF002499.7E-1564107IPR001005SANT/Myb domain
CDDcd001677.36E-1166109No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2666114IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MKGNAKKGLK KGPWTPEEDR ILVDYIQKHG HSKWKSVPAL AGLNRCGKSC RLRWTNYLRP  60
NIKRGNFSSE EEQLIIDLHA LMGNKWSAIA RHLPGRTDNE VKNLWNSRLK RKLIQMGIDP  120
ITHEPLTDPR LHQLLAAASF SNLINNPLDI INALMLQSDA VATLAKSLHL SHNMLQALAS  180
TPTTMASQDP TKACSTSNEY QFGSSSESLP VNVPNLDTTP QPIPPMAPRP TIVDDHHETN  240
NITNPSSTTF QEWDDFMDGG EASEPYWRDI IEYVYTSFFF FFFVLFFWL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2991135108B-MYB
1h8a_C2e-29911325128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012434999.10.0PREDICTED: transcription repressor MYB6-like isoform X2
SwissprotQ8GWP01e-61MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0D2PJS50.0A0A0D2PJS5_G
STRINGVIT_16s0039g01710.t011e-86(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3609622
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.22e-77myb domain protein 9